PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.E01577.1.p
Common NameEUGRSUZ_E01577, LOC104444435
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family HD-ZIP
Protein Properties Length: 298aa    MW: 32686.6 Da    PI: 7.4204
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.E01577.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox581.6e-18129183256
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       rk+ ++++eq  +Lee F+++++++ +++  LAk+l+L+ rqV vWFqNrRa+ k
  Eucgr.E01577.1.p 129 RKKLRLSREQSLVLEETFKEHNTLNPKQKLALAKQLNLSPRQVEVWFQNRRARTK 183
                       778899***********************************************98 PP

2HD-ZIP_I/II127.46.1e-41129218191
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                       +kk+rls+eq+ +LEe+F+e+++L+p++K +la++L+l+prqv+vWFqnrRARtktkq+E+d+e+Lkr++d+l++en+rL+kev+eLr +l
  Eucgr.E01577.1.p 129 RKKLRLSREQSLVLEETFKEHNTLNPKQKLALAKQLNLSPRQVEVWFQNRRARTKTKQTEVDCEYLKRCCDNLTQENKRLQKEVQELR-AL 218
                       69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046181.4E-25199IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.603.5E-19112185IPR009057Homeodomain-like
SuperFamilySSF466896.27E-20116187IPR009057Homeodomain-like
PROSITE profilePS5007117.67125185IPR001356Homeobox domain
SMARTSM003893.6E-17127189IPR001356Homeobox domain
PfamPF000466.0E-16129183IPR001356Homeobox domain
CDDcd000865.34E-17129186No hitNo description
PROSITE patternPS000270160183IPR017970Homeobox, conserved site
CDDcd146860.00537178217No hitNo description
SMARTSM003402.6E-25185228IPR003106Leucine zipper, homeobox-associated
PfamPF021831.0E-11185219IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MGEQDDGLGL SLSLGCGKSA LSLNLNLVEA PVQSRQSPGQ KCSWNEIFHS PETNSKTRPL  60
FGGVGVNRDI LVVDLDDDNH VSSPNSTVSS ISGKRSERDP HGDNEVEAER TSCSCESIEE  120
DGSGGDGARK KLRLSREQSL VLEETFKEHN TLNPKQKLAL AKQLNLSPRQ VEVWFQNRRA  180
RTKTKQTEVD CEYLKRCCDN LTQENKRLQK EVQELRALKL SPQLYMHMNP PTTLTMCPSC  240
QRVSVPSSSL SPPSSSSVTA SVIGPVGPVH NPFSQSGPSI NPWARLQMQQ GLNNLHS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1177185RRARTKTKQ
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.E01577.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010056406.10.0PREDICTED: homeobox-leucine zipper protein ATHB-4
SwissprotP929538e-91ATHB4_ARATH; Homeobox-leucine zipper protein ATHB-4
TrEMBLA0A059C3T50.0A0A059C3T5_EUCGR; Uncharacterized protein
STRINGPOPTR_0014s04460.11e-109(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25772772
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60390.11e-57homeobox-leucine zipper protein 3